CJC-1295 (NO-DAC) 10mg

Description

CJC-1295 (No DAC), commonly referred to as Modified GRF (1-29), is a modified synthetic 29-residue peptide supplied for controlled laboratory, analytical, and scientific research.

This form does not contain the Drug Affinity Complex modification associated with CJC-1295 with DAC. Its defined amino-acid substitutions, stereochemical configuration, and C-terminal amidation are important to its complete molecular identity.

Because commercial nomenclature may vary, the exact peptide form, salt or counter-ion state, purity specification, and lot-specific analytical profile should be confirmed using the applicable Certificate of Analysis.

Research Applications

CJC-1295 (No DAC) may be examined in controlled non-clinical research involving:

• Modified peptide characterization
• Sequence verification
• Ligand-receptor interaction studies
• Molecular signaling research
• Structure-function analysis
• Stereochemical characterization
• Comparative peptide analysis
• Chromatographic characterization
• Stability assessment

Experimental observations should remain specific to the applicable research system and should not be interpreted as evidence of hormonal benefit, growth-related benefit, performance enhancement, therapeutic effectiveness, or clinical suitability.

Structural Information

CJC-1295 (No DAC) is commonly represented as:

Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂

One-letter representation:

YADAIFTQSYRKVLAQLSARKLLQDILSR-NH₂

Key structural characteristics include:

• 29 amino-acid residues
• D-alanine substitution
• Defined modified sequence
• C-terminal amidation
• No DAC conjugation
• Product-dependent counter-ion characteristics

Analytical Identification

Relevant analytical characterization may include:

• Amino-acid sequence confirmation
• Molecular-mass assessment
• Stereochemical verification
• C-terminal amidation confirmation
• Chromatographic purity testing
• Peptide identity verification
• Counter-ion assessment
• Lot-specific quality analysis

Specifications & Documentation

Lot-specific documentation should be reviewed for:

• Confirmation of No DAC identity
• CAS number
• Complete amino-acid sequence
• Molecular formula
• Molecular weight
• Stereochemical configuration
• C-terminal modification
• Salt or counter-ion form
• Purity specification
• Analytical testing
• Lot or batch information
• Certificate of Analysis
• Storage requirements

Authenticated product-specific documentation should take precedence over generalized CJC-1295 naming.

Storage & Handling

Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.

Handling should follow established laboratory procedures appropriate for modified research peptide materials.

Research Use Only

CJC-1295 (No DAC) is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.

Disclaimer

For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, growth-related use, performance enhancement, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, hormonal, growth-related, performance-related, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.