PNC-127 10MG

Description

PNC-27 is a synthetic 32-residue chimeric peptide supplied for controlled laboratory, analytical, and scientific research. It combines a p53-derived peptide segment with a membrane-associated peptide sequence. Current reference sources consistently describe PNC-27 as a 32-residue experimental research peptide, not an approved therapeutic product.

Its defined sequence supports peptide identity testing, molecular-mass assessment, chromatographic characterization, sequence verification, and comparative structural research.

No established human clinical evidence supports therapeutic use, and the material should remain strictly positioned for laboratory research only.

Research Applications

PNC-27 may be examined in controlled non-clinical research involving:

• Chimeric peptide characterization
• Sequence verification
• Protein-peptide interaction studies
• Membrane-associated molecular research
• Structure-function analysis
• Chromatographic characterization
• Molecular-mass assessment
• Stability studies
• Non-clinical cellular and biochemical models

Published work remains preclinical, including laboratory and animal-model research, and should not be represented as evidence of human therapeutic effectiveness.

Structural Information

PNC-27 is represented by the sequence:

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Key structural characteristics include:

• 32 amino-acid residues
• Chimeric peptide architecture
• p53-derived sequence region
• Membrane-associated peptide segment
• Defined synthetic sequence
• Product-dependent counter-ion characteristics

Analytical Identification

Relevant analytical characterization may include:

• Amino-acid sequence confirmation
• Molecular-mass assessment
• Chromatographic purity testing
• Peptide identity verification
• Structural characterization
• Terminal-state confirmation
• Counter-ion assessment
• Lot-specific quality analysis

Specifications & Documentation

Lot-specific documentation should be reviewed for:

• PNC-27 identity
• CAS number
• Complete amino-acid sequence
• Molecular formula
• Molecular weight
• Terminal state
• Salt or counter-ion form
• Purity specification
• Analytical methodology
• Lot or batch information
• Certificate of Analysis
• Storage requirements

Authenticated product-specific documentation should take precedence over generalized reference values.

Storage & Handling

Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.

Follow established laboratory procedures appropriate for synthetic research peptide materials.

Research Use Only

PNC-27 is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.

Disclaimer

For research use only. Not for human or veterinary use. Not intended for consumption, administration, oncology use, anticancer use, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, anticancer, oncology-related, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.